XBP1_RAT Q9R1S4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9R1S4
Recommended name：X-box-binding protein 1 By Similarity
EC number：
Alternative names：X-box-binding protein 1, cytoplasmic form By Similarity X-box-binding protein 1, luminal form By Similarity
Cleaved into：
GeneID：NP_001004210.1
Gene names (primary )：Xbp1 By Similarity
Gene names (synonym )：Htf
Gene names (ORF )：
Length：267
Mass：29,665
Sequence：MVVVAAAPSAASAAPKVLLLSGQPASGGRALPLMVPGPRAAGSEASGTPQARKRQRLTHLSPEEKALRRKLKNRVAAQTARDRKKARMSELEQQVVDLEEENQKLQLENQLLREKTHGLVIENQELRTRLGMNALVTEEVSEAESKGNGVRLVAGSAESAALRLRAPLQQVQAQLSPPQNIFPWILTLLPLQILSLISFWAFWTSWTLSCFSNVLPQSLLIWRNSQRSTQKDLVPYQPPFLCQWGPHQPSWKPLMNSFVLTMYTPSL
Tissue specificity：
Induction：
Developmental stage：
Protein families：bZIP family