GLRX3_RAT   Q9JLZ1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9JLZ1

Recommended name:Glutaredoxin-3

EC number:

Alternative names:

Cleaved into:

GeneID:

Gene names  (primary ):Glrx3

Gene names  (synonym ):Picot, Txnl2

Gene names  (ORF ):

Length:337

Mass:37,849

Sequence:MAAGAAEAAEAAVAVVEVGSARQFEELLRLKTKSLLVVHFWAPWAPQCVQMNDVMAELAKEHPHVSFVKLEAEAVPEVSEKYEISSVPTFLFFKNSQKVDRLDGAHAPELTKKVQRHVSSGSFPPSTNEHVKEDLNLRLKKLTHAAPCMLFMKGTPQEPRCGFSKQMVEILHKHNIQFSSFDIFSDEEVRQGLKTYSNWPTYPQLYVSGELIGGLDIIKELEASEELDTICPKAPKLEERLKVLTNKASVMLFMKGNKQEAKCGFSKQILEILNSTGVEYETFDILEDEEVRQGLKTFSNWPTYPQLYVRGDLVGGLDIVKELKDNGELLPILKGEN

Tissue specificity:In neonatal cardiomyocytes after exposure to the hypertrophic agonists EDN1 (ET-1) or phenylephrine (PE). In transverse aortic constriction (TAC) induced cardiac hypertrophy in adult hearts. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp