RASD1_RAT Q9JKF8
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JKF8
Recommended name：Dexamethasone-induced Ras-related protein 1
EC number：
Alternative names：
Cleaved into：
GeneID：64455
Gene names (primary )：Rasd1
Gene names (synonym )：Dexras1
Gene names (ORF )：
Length：280
Mass：31,714
Sequence：MKLAAMIKKMCPSDSELSIPAKNCYRMVILGSSKVGKTAIVSRFLTGRFEDAYTPTIEDFHRKFYSIRGEVYQLDILDTSGNHPFPAMRRLSILTGDVFILVFSLDNRDSFEEVQRLKQQILDTKSCLKNKTKENVDVPLVICGNKGDRDFYREVEQREIEQLVGDDPQRCAYFEISAKKNSSLDQMFRALFAMAKLPSEMSPDLHRKVSVQYCDVLHKKALRNKKLLRAGSGGGGDHGDAFGILAPFARRPSVHSDLMYIREKTSVSSQAKDKERCVIS
Tissue specificity：Prominently found in brain at both mRNA and protein levels. Moderate expression in testis and lung. Slightly expressed in heart, spleen, skeletal muscle, liver and kidney. 1
Induction：
Developmental stage：
Protein families：