NPT2B_RAT Q9JJ09
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9JJ09
Recommended name：Sodium-dependent phosphate transport protein 2B
EC number：
Alternative names：Na(+)-dependent phosphate cotransporter 2B Sodium/phosphate cotransporter 2B (Na(+)/Pi cotransporter 2B; NaPi-2b) Solute carrier family 34 member 2 (rNaPi IIb)
Cleaved into：
GeneID：84395
Gene names (primary )：Slc34a2
Gene names (synonym )：
Gene names (ORF )：
Length：695
Mass：75,992
Sequence：MAPWPELENAHPNPNKFIEGASGPQSSIPDKDKGTSKTNDSGTPVAKIELLPSYSALVLIEEPPEGNDPWDLPELQDNGIKWSERDSKGKILCIFQGIGKFILLLGFLYLFVCSLDVLSSAFQLVGGKMAGQFFSNNSIMSNPVAGLVIGVLVTVMVQSSSTSSSIIVSMVASSLLSVRAAIPIIMGANIGTSITNTIVALMQAGDRNEFRRAFAGATVHDFFNWLSVLVLLPLEAATHYLEKLTNLVLETFSFQNGEDAPDILKVITDPFTKLIIQLDKKVIQQIAMGDSEAQNKSLIKIWCKTISNVIEENVTVPSPDNCTSPSYCWTDGIQTWTIQNVTEKENIAKCQHIFVNFSLPDLAVGIILLTVSLLILCGCLIMIVKLLGSVLRGQVATVIKKTLNTDFPFPFAWLTGYLAILVGAGMTFIVQSSSVFTSAMTPLIGIGVISIERAYPLTLGSNIGTTTTAILAALASPGNTLRSSLQIALCHFFFNISGILLWYPIPFTRLPIRLAKGLGNISAKYRWFAVFYLIFFFLLTPLTVFGLSLAGWPVLVGVGVPIILLILLVLCLRMLQARCPRILPLKLRDWNFLPLWMHSLKPWDNIISLATSCFQRRCCCCCRVCCRVCCMVCGCKCCRCSKCCKNLEEEEKEQDVPVKASGGFDNTAMSKECQDEGKGQVEVLGMKALSNTTVF
Tissue specificity：Highly expressed in the lung, in type II alveolar cells. Moderately expressed in kidney followed by small intestine. 1
Induction：Appears on embryonic day 16.5 and is expressed thereafter. 1 Publication
Developmental stage：Up-regulated by estrogen. 1
Protein families：