KCNKD_RAT Q9ERS0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q9ERS0
Recommended name：Potassium channel subfamily K member 13
EC number：
Alternative names：
Cleaved into：
GeneID：64120
Gene names (primary )：Kcnk13
Gene names (synonym )：
Gene names (ORF )：
Length：405
Mass：45,081
Sequence：MAGRGCSCSPGHLNEDNARFLLLAGLILLYLLGGAAVFSALELAQELQAKQRWEERLANFSRGHNLSREELRGFLRHYEEATKAGIRMDSVRPRWDFTGAFYFVGTVVTTIGFGMTTPATTGGKVFLIFYGLIGCASTILFFNLFLERLITVIAYVMRTCHHQQLRRRGTVARDNRKAPRKGEADSLAGWKPSVYYVMLILCLASVAISCGASALYTTMEGWSYFDSVYFCFVASSTIGFGDLVSSQNAQYENEGLYRFVNFFFILMGVCCIYSMFNVISILIKQTVNWILRKLDSGCFPQCQRGLLRSRRNVVMPGNIRNRCNISIETDGVMESDTDGRRLSGEMISMKDTNKVSLAILQKQLSEMANGGPHQTSTSSRDDEFSGGVGAFAVMNNRLAETSGDR
Tissue specificity：Ubiquitous. In brain expression is rather low and restricted to the olfactory bulb and tubercle, to the ventromedial hypothalamic nucleus, lateral septal nucleus dorsal, lateral mammillary nucleus, lateral parabrachial nuclei, reticular nucleus and reunions nuclei. 1
Induction：
Developmental stage：
Protein families：two pore domain potassium channel (TC 1.A.1.8) family