B2L10_RAT Q99M66
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q99M66
Recommended name：Bcl-2-like protein 10 Imported
EC number：
Alternative names：Anti-apoptotic protein Boo By Similarity Apoptosis regulator Bcl-B By Similarity
Cleaved into：
GeneID：114552
Gene names (primary )：Bcl2l10 1 Publication
Gene names (synonym )：Bcl-b By Similarity, Boo By Similarity, Diva By Similarity
Gene names (ORF )：
Length：185
Mass：21,859
Sequence：MGDPLQDRTRRLLTDYILFCARAPNTPEPLPTSVEAALLRSVTSQIQQEHQDLFNSFRDYQGNRLELVTQMADELLSNDQEFNWGRLVMLLAFVGTLMNQDRTVKRRRDQRNRLLLERDCYLIVSLLYNRLTGRHRSWLEAHGGWDGFCQFFKNPLPPGFWRRLLIRAILSCFFATAIFYIWKCL
Tissue specificity：Expressed in oligodendroglial lineage cells. 1
Induction：
Developmental stage：
Protein families：