ZDHC7_RAT Q923G5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q923G5
Recommended name：Palmitoyltransferase ZDHHC7 Curated
EC number：EC:2.3.1.225
Alternative names：Acyltransferase ZDHHC7 By Similarity (EC:2.3.1.- By Similarity) . EC:2.3.1.- (UniProtKB | ENZYME | Rhea) By Similarity Sertoli cell gene with a zinc finger domain protein 1 Publication Zinc finger DHHC domain-containing protein 7 Imported (DHHC7 Imported)
Cleaved into：
GeneID：170906
Gene names (primary )：Zdhhc7
Gene names (synonym )：Serz 1 Publication
Gene names (ORF )：
Length：308
Mass：35,231
Sequence：MQPSGHRLRDIEHHPLLTDNDNYDSASSSSSEADMADRVWFIRDGCGMVCAVMTWLLVVYADFVVTFVMLLPSKDFWYSVVNGVLFNCLAVLALSSHLRTMLTDPGAVPKGNATKEYMESLQLKPGEVIYKCPKCCCIKPERAHHCSICKRCIRKMDHHCPWVNNCVGEKNQRFFVLFTMYIALSSIHALILCGLQFISCVRGQWTECSDFSPPITVILLVFLCLEGLLFFTFTAVMFGTQIHSICNDETEIERLKSEKPTWERRLRWEGMKSVFGGPPSLLWMNPFVGFRFRRLQMRTRKGGPEFSV
Tissue specificity：Widely expressed. Present in Sertoli cells (at protein level). 1
Induction：
Developmental stage：
Protein families：DHHC palmitoyltransferase family