ELOV6_RAT Q920L6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q920L6
Recommended name：Very long chain fatty acid elongase 6 UniRule Annotation Curated
EC number：EC:2.3.1.199
Alternative names：3-keto acyl-CoA synthase Elovl6 UniRule Annotation ELOVL fatty acid elongase 6 UniRule Annotation (ELOVL FA elongase 6 UniRule Annotation) Elongation of very long chain fatty acids protein 6 UniRule Annotation Fatty acid elongase 2 (rELO2) Fatty acyl-CoA elongase More alternative names
Cleaved into：
GeneID：171402
Gene names (primary )：Elovl6 UniRule Annotation
Gene names (synonym )：Face, Lce
Gene names (ORF )：
Length：267
Mass：31,624
Sequence：MNMSVLTLQEYEFEKQFNENEAIQWMQENWKKSFLFSALYAAFIFGGRHLMNKRAKFELRKPLVLWSLTLAVFSIFGALRTGAYMLYILMTKGLKQSVCDQSFYNGPVSKFWAYAFVLSKAPELGDTIFIILRKQKLIFLHWYHHITVLLYSWYSYKDMVAGGGWFMTMNYGVHAVMYSYYALRAAGFRVSRKFAMFITLSQITQMLMGCVINYLVFNWMQHDNDQCYSHFQNIFWSSLMYLSYLLLFCHFFFEAYIGKVKKATKAE
Tissue specificity：Expressed in liver and barely in brain. 1
Induction：
Developmental stage：
Protein families：