CREST_RAT Q91XJ0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q91XJ0
Recommended name：Calcium-responsive transcription coactivator
EC number：
Alternative names：
Cleaved into：
GeneID：192352
Gene names (primary )：Ss18l1
Gene names (synonym )：Crest
Gene names (ORF )：
Length：401
Mass：43,999
Sequence：MSVAFASARPRGKGEVTQQTIQKMLDENHHLIQCILDYQSKGKTAECTQYQQILHRNLVYLATIADSNQNMQSLLPAPPTQNMNLGPGALSQSGSSQGLHPQGSLSDTVSTGLPPASLMQGQIGNGPNHVSMQQTAQSTLPTTSMSMSGSGHGTGPGYSHSGPTSQSVPMQGQGAISNYVSRTNINMQSNPVSMMHQQAARPTTTQRRVEASITRARRPLHDGPGWQGGSMMGQRPMAPYRPSQQGSSQQYLGQEEYYSEQYSHSQGSAEPMSQQYYPDGHSDYAYQQSSYTEQSYDRSFEDPTQHYYEGGNSQYSQQQAGYQQGTAQQQTYSQQQYPNQQSYPGQQQGYGPAQGAPSQYSGYQQGQGQQYGSYRTSQTGPSAQQQRPYGYEQGQYGNYQQ
Tissue specificity：Brain (at protein level). Also found in the heart, liver, kidney and testis. 1
Induction：
Developmental stage：Detected as early as 18 dpc in the developing cerebral cortex, and expression reaches its peak at P1, declines after P10, and remains at a relatively low level throughout adulthood. At 18 dpc, expressed in the forebrain, midbrain, and hindbrain. Within the forebrain, it is expressed in postmitotic cells of the cortical plate. At this stage, it can also be detected in other structures of central and peripheral nervous systems, including the trigeminal ganglion, superior cervical ganglion, retina and olfactory epithelium. Expression in the cortex is high at birth and declines substantially by P20. At P7, expressed in all cortical layers, and in the hippocampus, expression is high in the cell body layers of all subdivisions. Within the brain, expression decreases through development but continues to be expressed at high levels in the olfactory bulb, hippocampus, and cerebellum into adulthood. 1
Protein families：SS18 family