R4RL2_RAT   Q80WD1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q80WD1

Recommended name:Reticulon-4 receptor-like 2

EC number:

Alternative names:

Cleaved into:

GeneID:311169

Gene names  (primary ):Rtn4rl2

Gene names  (synonym ):Ngrh1 1 Publication Imported

Gene names  (ORF ):

Length:420

Mass:46,184

Sequence:MLPGLRRLLQGPASACLLLTLLALPPVTPSCPMLCTCYSSPPTVSCQANNFSSVPLSLPPSTQRLFLQNNLIRSLRPGTFGPNLLTLWLFSNNLSTIYPGTFRHLQALEELDLGDNRHLRSLEPDTFQGLERLQSLHLYRCQLSSLPGNIFRGLVSLQYLYLQENSLLHLQDDLFADLANLSHLFLHGNRLRLLTEHVFRGLGSLDRLLLHGNRLQGVHRAAFHGLSRLTILYLFNNSLASLPGEALADLPALEFLRLNANPWACDCRARPLWAWFQRARVSSSDVTCATPPERQGRDLRTLRDTDFQACPPPTPTRPGSRARGNSSSNHLYGVAEAGAPPADPSTLYRDLPAEDSRGRQGGDAPTEDDYWGGYGGEDQRGEQTCPGAACQAPADSRGPVLSAGLRTPLLCLLLLAPHHL

Tissue specificity:Detected in adult brain, in neocortex, hippocampus, striatum and dorsal root ganglion neurons, and in retina (at protein level) (PubMed:15673660). In brain, detected in cerebral cortex and hippocampus. Weak or no expression detected in the cerebellum, thalamus or striatum (PubMed:12694398). 2 s

Induction:

Developmental stage:Expression is high in adult, but very low in neonate dorsal root ganglion neurons (at protein level). 1

Protein families:


   💬 WhatsApp