TOM22_RAT   Q75Q41


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q75Q41

Recommended name:Mitochondrial import receptor subunit TOM22 homolog

EC number:

Alternative names:Translocase of outer membrane 22 kDa subunit homolog

Cleaved into:

GeneID:300075

Gene names  (primary ):Tomm22

Gene names  (synonym ):Tom22

Gene names  (ORF ):

Length:142

Mass:15,491

Sequence:MAAAVAAAGAGEPLSPEELVPKAEAEKAEEDLEEDDDDELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPPLPGKI

Tissue specificity:

Induction:

Developmental stage:

Protein families:Tom22 family


   💬 WhatsApp