TOM22_RAT Q75Q41
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q75Q41
Recommended name:Mitochondrial import receptor subunit TOM22 homolog
EC number:
Alternative names:Translocase of outer membrane 22 kDa subunit homolog
Cleaved into:
GeneID:300075
Gene names (primary ):Tomm22
Gene names (synonym ):Tom22
Gene names (ORF ):
Length:142
Mass:15,491
Sequence:MAAAVAAAGAGEPLSPEELVPKAEAEKAEEDLEEDDDDELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPPLPGKI
Tissue specificity:
Induction:
Developmental stage:
Protein families:Tom22 family