DHB8_RAT Q6MGB5
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6MGB5
Recommended name：(3R)-3-hydroxyacyl-CoA dehydrogenase
EC number：
Alternative names：17-beta-hydroxysteroid dehydrogenase 8 (17-beta-HSD 8) 3-ketoacyl-[acyl-carrier-protein] reductase alpha subunit By Similarity (KAR alpha subunit By Similarity) 3-oxoacyl-[acyl-carrier-protein] reductase Estradiol 17-beta-dehydrogenase 8 (EC:1.1.1.62 By Similarity) . EC:1.1.1.62 (UniProtKB | ENZYME | Rhea) By Similarity Testosterone 17-beta-dehydrogenase 8 (EC:1.1.1.239 By Similarity) . EC:1.1.1.239 (UniProtKB | ENZYME | Rhea) By Similarity
Cleaved into：
GeneID：361802
Gene names (primary )：Hsd17b8
Gene names (synonym )：
Gene names (ORF )：
Length：259
Mass：26,791
Sequence：MASQLRLRSALALVTGAGSGIGRAISVRLAAEGAAVAACDLDGAAAQDTVRLLGNPGSEDREPRGKHAAFQADVSEGPAAKRLLEQVQACFFRPPSVVVSCAGITRDEFLLHMSEEDWDRVIAVNLKGTFLVTQAAAQALVSSGGRGSIINISSIVGKVGNIGQTNYASSKAGVIGLTQTAARELGRHGIRCNSVLPGFIATPMTQKMPEKVKDKVTAMIPLGHMGDPEDVADVVAFLASEDSGYITGASVEVSGGLFM
Tissue specificity：Expressed in ovary at protein level. 1
Induction：
Developmental stage：
Protein families：