ABHGA_RAT Q6MG55
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6MG55
Recommended name：Phosphatidylserine lipase ABHD16A Curated
EC number：
Alternative names：Alpha/beta hydrolase domain-containing protein 16A Curated (Abhydrolase domain-containing protein 16A Curated) HLA-B-associated transcript 5 homolog By Similarity Monoacylglycerol lipase ABHD16A Curated (EC:3.1.1.23 By Similarity) . EC:3.1.1.23 (UniProtKB | ENZYME | Rhea) By Similarity
Cleaved into：
GeneID：361796
Gene names (primary )：Abhd16a
Gene names (synonym )：Bat5 By Similarity
Gene names (ORF )：
Length：558
Mass：63,038
Sequence：MAKLLSCVLGPRLYKIYRERDTDRAATSVPETPTAVPAASSSSWDSYYQPRALEKHADSILALASVFWSISYYSSPFAFFYLYRKGYLSLSKVVPFSHYAGTLLVLLAGVACLRGIGRWTNPQYRQFITILEATHRNQSAENKRQLANYNFDFRSWPVDFHWEEPSSRKGSRGGPSRRGVALLRPEPLHRGTADTFLNRVKKLPCQITSYLVAHTLGRRMLYPGSVYLLQKALMPVLLQGQARLVEECNGRRAKLLACDGNEIDTMFVDRRGTAEPQGQKLVICCEGNAGFYEVGCVSTPLEAGYSVLGWNHPGFAGSTGVPFPQNEANAMDVVVQFAIHRLGFQPQDIVIYAWSIGGFTATWAAMSYPDISAVILDASFDDLVPLALKVMPDSWRALVTRTVRQHLNLNNAEQLCRFQGPVLLVRRTKDEIITTTVPEDIMSNRGNDLLLKLLQFRYPRVMTEEGLRAVRQWLEASSQLEEASIYSRWEVDEDWCVSVLRSYQAEHGPDFPWSVGEDMSVDGRRQLALFLARKHLHNFEATHCTPLPAQHFQMPWCL
Tissue specificity：
Induction：
Developmental stage：
Protein families：