PPR3B_RAT Q6IN01
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6IN01
Recommended name：Protein phosphatase 1 regulatory subunit 3B
EC number：
Alternative names：
Cleaved into：
GeneID：192280
Gene names (primary )：Ppp1r3b
Gene names (synonym )：Ppp1r4
Gene names (ORF )：
Length：284
Mass：32,626
Sequence：MAVDIEYSYSSMAPSLRRERFTFKISPKLNKPLRPCIQLGSKDEAGRMVAPTVQEKKVKKRVSFADNQGLALTMVKVFSEFDDPLDIPFNITELLDNIVSLTTAESESFVLDFPQPSADYLDFRNRLQTNHVCLENCVLKEKAIAGTVKVQNLAFEKVVKIRMTFDTWKSFTDFPCQYVKDTYAGSDRDTFSFDISLPEKIQSYERMEFAVCYECNGQSYWDSNKGKNYRITRAELRSTQGMTEPYNGPDFGISFDQFGSPRCSFGLFPEWPSYLGYEKLGPYY
Tissue specificity：Highly expressed in liver. Moderately expressed in kidney, heart, testis, spleen and lung. Weakly expressed in skeletal muscle (at protein level). Expressed predominantly in liver. Expressed moderately in heart. Expressed weakly in lung, kidney, spleen and skeletal muscle. 2 s
Induction：
Developmental stage：
Protein families：