RAB31_RAT   Q6GQP4


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6GQP4

Recommended name:Ras-related protein Rab-31

EC number:EC:3.6.5.2

Alternative names:GTP-binding protein Rab0

Cleaved into:

GeneID:246324

Gene names  (primary ):Rab31

Gene names  (synonym ):

Gene names  (ORF ):

Length:195

Mass:21,500

Sequence:MMAIRELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTKTVPCGNELHKFLIWDTAGQERFHSLAPMYYRGSAAAVIVYDITKQDSFHTLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGALVVETSAKNAINIEELFQGISRQIPPLDPHENGNSGGIKLGNQSLQAGRRCC

Tissue specificity:Detected in brain astrocytes, spleen and intestine (at protein level). 2 s

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp