CLC4D_RAT   Q69FH1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q69FH1

Recommended name:C-type lectin domain family 4 member D

EC number:

Alternative names:CD368

Cleaved into:

GeneID:362432

Gene names  (primary ):Clec4d

Gene names  (synonym ):Clecsf8, Mcl

Gene names  (ORF ):

Length:218

Mass:25,312

Sequence:MWLEESQMKSKGALHPRRIPWVCAVVSISFLSACFISTCVVTHYFLLWKRGSALKFSDYHTRLTCILEEPQPGATGGTWTCCPVSWRAFQSNCYFALNDNQTWHESERNCSGMSSHLVTINTEAEQDFVTQLLDEQFSYFLGLSYEKVEGQWQWVDKTPFNPNVVFWKVGEPKDSMEEDCVVLVYDQDKWVWNDFPCHFEMGRICKLPGATFDWNPSK

Tissue specificity:Expressed in myeloid cells (dendritic cells, macrophages and neutrophils) and B-cells. 2 s

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp