NEUR2_RAT Q64627
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q64627
Recommended name：Sialidase-2
EC number：EC:3.2.1.18
Alternative names：Cytosolic sialidase N-acetyl-alpha-neuraminidase 2
Cleaved into：
GeneID：
Gene names (primary )：Neu2
Gene names (synonym )：
Gene names (ORF )：
Length：379
Mass：42,382
Sequence：METCPVLQKETLFHTEVYAYRIPALLYLKKQKTLLAFAEKRASRTDEHAELIVLRRGSYNGATNHVKWQPEEVVTQAQLEGHRSMNPCPLYDKQTKTLFLFFIAVPGRVSEQHQLQTRVNVTRLCRVTSTDYGMNWSPVQDLTETTIGSTHQDWATFAVGPGHCLQLRNRAGSLLVPAYAYRKLHPVHKPTPFAFCFISLDHGHTWELGNFVSENSLECQVAEVGTGAHRVVYLNARSFIGARVQAQSPNDGLDFQDNQVVSKLVEPPHGCHGSVVAFHSPTSKPDCLRHVAAYTHPTDSRNRTNLGVYLNQTPLDPTAWSEPTLLATGTCAYSDLQIWGLGPDGSPQFGCLYESGNYDEIIFLMFTLKQAFPTVHGAQ
Tissue specificity：Detected in skeletal muscle. 1
Induction：
Developmental stage：
Protein families：