AT1B3_RAT Q63377
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q63377
Recommended name：Sodium/potassium-transporting ATPase subunit beta-3
EC number：
Alternative names：CD298
Cleaved into：
GeneID：25390
Gene names (primary )：Atp1b3
Gene names (synonym )：
Gene names (ORF )：
Length：279
Mass：31,830
Sequence：MTKTEKKSFHQSLAEWKLFIYNPTSGEFLGRTSKSWGLILLFYLVFYGFLAALFTFTMWVMLQTLNDEVPKYRDQIPSPGLMVFPKPPTALDYTYSMSDPHTYKKFVEDLKNFLKPYSVEEQKNLTDCPGGALFHQEGPDYSACQFPVSLLQECSGVNDSNFGYSKGQPCVLVKMNRIIELVPDGAPYITCITKEENIANIVTYPDDGLIDLKYFPYYGKKRHVGYRQPLVAVQVIFGADATKKEVTIECQIDGTRNLKNKNERDKFLGRVSFKVIAHA
Tissue specificity：Expressed in distal colon, proximal colon, ileum, jejunum, stomach, liver, lung, kidney, spleen, and heart (PubMed:9950762). Expressed in the brain, testes and anterior prostate (at protein level) (PubMed:14749213). 2 s
Induction：
Developmental stage：Up-regulated in distal colon in response to K+ free diet. 1
Protein families：X(+)/potassium ATPases subunit beta family