UHMK1_RAT   Q63285


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q63285

Recommended name:Serine/threonine-protein kinase Kist

EC number:EC:2.7.11.1

Alternative names:Kinase interacting with stathmin PAM COOH-terminal interactor protein 2 (P-CIP2) U2AF homology motif kinase 1

Cleaved into:

GeneID:246332

Gene names  (primary ):Uhmk1

Gene names  (synonym ):Kis, Kist

Gene names  (ORF ):

Length:419

Mass:46,505

Sequence:MAGSGCAWGAEPPRFLEAFGRLWQVQSRLGSGSSASVYRVRCCGTPGSPPGALKQFLPPGTTGAAASAAEYGFRKERAALEQLQGHRNIVTLYGVFTIHFSPNVPSRCLLLELLDVSVSELLVYSSHQGCSMWMIQHCARDVLEALAFLHHEGYVHADLKPRNILWSAENECFKLIDFGLSFKEGNQDVKYIQTDGYRAPEAELQNCLAQAGLQSDTECTSAVDLWSLGIILLEMFSGMKLKHTVRSQEWKANSSAIIDHIFASKAVVNAAIPAYHLRDLIKSMLHDDPSRRIPAEMALCSPFFSIPFAPHIEDLVMLPTPVLRLLNVLDDDYLENEDEYEDVVEDVKEECQKYGPVVSLLVPKENPGRGQVFVEYANAGDSKAAQKLLTGRMFDGKFVVATFYPLSAYKRGYLYQTLL

Tissue specificity:In the embryo, preferentially expressed in the developing nervous system. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp