FKB1A_RAT Q62658
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q62658
Recommended name：Peptidyl-prolyl cis-trans isomerase FKBP1A
EC number：EC:5.2.1.8
Alternative names：PPIase FKBP1A
Cleaved into：
GeneID：25639
Gene names (primary )：Fkbp1a
Gene names (synonym )：Fkbp1
Gene names (ORF )：
Length：108
Mass：11,923
Sequence：MGVQVETISSGDGRTFPKRGQTCVVHYTGMLEDGKKFDSSRDRNKPFKFTLGKQEVIRGWEEGVAQMSVGQRAKLIISPDYAYGATGHPGIIPPHATLVFDVELLKLE
Tissue specificity：Ubiquitous. 1
Induction：
Developmental stage：
Protein families：