EGLN3_RAT Q62630
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q62630
Recommended name：Prolyl hydroxylase EGLN3 Curated
EC number：EC:1.14.11.-
Alternative names：Egl nine homolog 3 (EC:1.14.11.29 By Similarity) . EC:1.14.11.29 (UniProtKB | ENZYME | Rhea) By Similarity Hypoxia-inducible factor prolyl hydroxylase 3 (HIF-PH3; HIF-prolyl hydroxylase 3; HPH-3) Prolyl hydroxylase domain-containing protein 3 (PHD3) SM-20 2 Publications
Cleaved into：
GeneID：54702
Gene names (primary )：Egln3
Gene names (synonym )：Sm20 2 Publications
Gene names (ORF )：
Length：239
Mass：27,242
Sequence：MPLGHIMRLDLEKIALEYIVPCLHEVGFCYLDNFLGEVVGDCVLERVKQLHYNGALRDGQLAGPRAGVSKRHLRGDQITWIGGNEEGCEAINFLLSLIDRLVLYCGSRLGKYYVKERSKAMVACYPGNGTGYVRHVDNPNGDGRCITCIYYLNKNWDAKLHGGVLRIFPEGKSFVADVEPIFDRLLFSWSDRRNPHEVQPSYATRYAMTVWYFDAEERAEAKKKFRNLTRKTESALAKD
Tissue specificity：Highly expressed in vascular smooth muscle. Moderately expressed in esophagus, stomach, small bowel and aorta. Low levels in tail and kidney. Expression also in pheochromocytoma cell line PC-12. 4 s
Induction：
Developmental stage：By PDGF and angiotensin II in aortic smooth muscle cells. By deprivation of NGF in neuronal cell cultures. Induced during coronary heart ligation. 4 s
Protein families：