CYBR1_RAT Q5RKJ2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q5RKJ2
Recommended name：Plasma membrane ascorbate-dependent reductase CYBRD1 By Similarity
EC number：EC:7.2.1.3
Alternative names：Cytochrome b reductase 1 Duodenal cytochrome b 1 Publication
Cleaved into：
GeneID：295669
Gene names (primary )：Cybrd1
Gene names (synonym )：Dcytb 1 Publication
Gene names (ORF )：
Length：286
Mass：31,519
Sequence：MAMEGYRGFLGLLVSALLVGFLSVIFVLIWVLHFREGLGWDGGALEFNWHPVLAVTGFVFIQGIAIIVYRLPWTWKCSKFLMKSIHAGLNAVAAILAIISVVAVFDYHNVRKIPHMYSLHSWVGLTVLILYIQQLVVGFFIFLLPWAPPSLRAIVMPIHVYSGLLLFGTVIATVLMGVTEKLFFVLKNPSYHSFPPEGVFTNTLGLLILVFGALIFWIVTRPQWKRPREPGSIPLQLNGGNADGMEGAIAISSAHNMDAADAELSSEGAARKRTLGLVDTGQRSTM
Tissue specificity：Highly expressed in all regions of the small intestine and colon studied in suckling animals. However, after weaning, when iron absorption declines significantly, strong expression is retained only in the duodenum. Also expressed in respiratory epithelium. 2 s
Induction：
Developmental stage：
Protein families：