TARG1_RAT Q2MHH0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q2MHH0
Recommended name：Trafficking regulator of GLUT4 1
EC number：
Alternative names：
Cleaved into：
GeneID：360576
Gene names (primary )：Trarg1
Gene names (synonym )：Tusc5
Gene names (ORF )：
Length：173
Mass：18,722
Sequence：MANPVQPQLQDPGSTSPLDLPEMEKLLTKVENKDDQALNLSKSLSGALDLEQNGHSLPFKVISEGHRQPSLSGSPSRASSRRASSVVTTSYAQDQEAPKDYLVLAIASCFCPVWPLNLIPLIFSIMSRSSVQQGDLDGARRLGRLARLLSITFIILGIVIIIVAVTVNFTVPK
Tissue specificity：Present in adipose tissue and undetectable in other tissues (at protein level). 3 s
Induction：Up-regulated during differentiation in primary cultured rat brown preadipocytes. 1 Publication
Developmental stage：Down-regulated upon cold exposure in brown adipose tissue in Zucker lean rats. Down-regulated by dexamethasone. 1
Protein families：