CXCL3_RAT Q10746
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q10746
Recommended name：C-X-C motif chemokine 3
EC number：
Alternative names：
Cleaved into：
GeneID：
Gene names (primary )：Cxcl3
Gene names (synonym )：Cinc2
Gene names (ORF )：
Length：101
Mass：11,109
Sequence：MAPPTRRLLNAALLLLLLLMATSHQPSGTVVARELRCQCLKTLPRVDFENIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQAPRLQKIIQKLLKSDKSS
Tissue specificity：By lipopolysaccharide. Expression increases until 4 hours after treatment and then gradually decreases, remaining high 24 hours after stimulation. 1
Induction：
Developmental stage：
Protein families：