CXCL3_RAT   Q10746


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q10746

Recommended name:C-X-C motif chemokine 3

EC number:

Alternative names:

Cleaved into:

GeneID:

Gene names  (primary ):Cxcl3

Gene names  (synonym ):Cinc2

Gene names  (ORF ):

Length:101

Mass:11,109

Sequence:MAPPTRRLLNAALLLLLLLMATSHQPSGTVVARELRCQCLKTLPRVDFENIQSLTVTPPGPHCTQTEVIATLKDGQEVCLNPQAPRLQKIIQKLLKSDKSS

Tissue specificity:By lipopolysaccharide. Expression increases until 4 hours after treatment and then gradually decreases, remaining high 24 hours after stimulation. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp