CCL20_RAT   P97884


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P97884

Recommended name:C-C motif chemokine 20

EC number:

Alternative names:

Cleaved into:

GeneID:29538

Gene names  (primary ):Ccl20

Gene names  (synonym ):Scya20, St38

Gene names  (ORF ):

Length:96

Mass:10,875

Sequence:MACKHLPFLALAGVLLAYLCSQSEAASNFDCCLTYTKNVYHHARNFVGFTTQMADEACDINAIIFHLKSKRSVCADPKQIWVKRILHLLSLRTKKM

Tissue specificity:Low levels in thymus and lung.

Induction:

Developmental stage:By TNF in experimental allergic panencaphalomyelitis (EAP) and by TNF and IL-1 in primary astrocytes.

Protein families:


   💬 WhatsApp