THIOM_RAT   P97615


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P97615

Recommended name:Thioredoxin, mitochondrial

EC number:

Alternative names:Thioredoxin-2

Cleaved into:

GeneID:79462

Gene names  (primary ):Txn2

Gene names  (synonym ):Trx2

Gene names  (ORF ):

Length:166

Mass:18,232

Sequence:MAQRLLLRRFLTSVISRKPPQGVWASLTSTSLQTPPYNAGGLTGTPSPARTFHTTRVCSTTFNVQDGPDFQDRVVNSETPVVVDFHAQWCGPCKILGPRLEKMVAKQHGKVVMAKVDIDDHTDLAIEYEVSAVPTVLAIKNGDVVDKFVGIKDEDQLEAFLKKLIG

Tissue specificity:Expressed in several tissues with the highest expression levels in heart, muscle, kidney and adrenal gland. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp