DTNB_RAT P84060
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P84060
Recommended name：Dystrobrevin beta Curated
EC number：
Alternative names：Beta-dystrobrevin By Similarity
Cleaved into：
GeneID：
Gene names (primary )：Dtnb
Gene names (synonym )：
Gene names (ORF )：
Length：654
Mass：73,878
Sequence：MIEEGGNKRKTMAEKRQLFIEMRAQNFDVIRLSTYRTACKLRFVQKRCNLHLVDIWNMIEAFRDNGLNTLDHATEISVSRLETVISSIYYQLNKRLPSTHQINVEQSISLLLNFMIAAYDSEGRGKLTVFSVKAMLATMCGGKMLDKLRYIFSQMSDSNGLMMFGKLDQFLKEALKLPTAVFEGPSFGYTEHAVRTCFPQQKKIMLNMFLDTMMADPPPQCLVWLPLMHRLAHVENVFHPVECSYCHCESMMGFRYRCQQCHNYQLCQNCFWRGHAGGPHSNQHQMKELSSWKSPAKKLSHAISKSLGCVPSREPPHPVFPEQPEKPLDLAHIVPPRPLTNMNDTMVSHMSSGVPTPTKRLQYGQDMPNLLADEHALIASYVARLQHCTRVLDSPSRLDEEHRLIARYAARLAAEAGNMTRPPTDASFNFDANKQQRQLIAELENKNREILQEIQRLRLEHEQASQPTPEKAQQNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEGLMKLLKAQATGSPHTSPTHGGGRSMPMPVRSTSAGSTPTHGPQDSLSGVGGDVQEAFAQGTRRNLRNDLLVAADSITNTMSSLVKELHSGETQRFPLVSSSPSCPLPCPTIPTHSPSFHATFPSRNTRDLHPVPPSHMVSLY
Tissue specificity：Expressed in neurons. In the isocortex, expressed most prominently in the somata (including the nuclei) and the dendrites of the pyramidal cells. Expressed in the hippocampus CA1, CA2, and CA3 neurons, namely in the initial segments of dendrites. Expressed in the Purkinje cells, molecular layer interneurons, and granule cells of cerebellum. Expressed in axon fascicles associated with the spinal trigeminal tract and in the internal capsule in the brainstem. 1
Induction：
Developmental stage：
Protein families：dystrophin family