RALA_RAT   P63322


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P63322

Recommended name:Ras-related protein Ral-A

EC number:EC:3.6.5.2

Alternative names:

Cleaved into:

GeneID:81757

Gene names  (primary ):Rala

Gene names  (synonym ):Ral, Ral-a

Gene names  (ORF ):

Length:206

Mass:23,553

Sequence:MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGEEVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENVPFLLVGNKSDLEDKRQVSVEEAKNRADQWNVNYVETSAKTRANVDKVFFDLMREIRARKMEDSKEKNGKKKRKSLAKRIRERCCIL

Tissue specificity:Higher levels where found in testes followed by brain, adrenal gland, pituitary gland, ovary, liver and kidney. Low expression was found in muscle. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp