RL40_RAT P62986
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P62986
Recommended name:Ubiquitin-ribosomal protein eL40 fusion protein Curated
EC number:
Alternative names:Ubiquitin Large ribosomal subunit protein eL40 Curated Alternative names: 60S ribosomal protein L40, CEP52
Cleaved into:
GeneID:64156
Gene names (primary ):Uba52
Gene names (synonym ):Ubcep2
Gene names (ORF ):
Length:128
Mass:14,728
Sequence:MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLRQLAQKYNCDKMICRKCYARLHPRAVNCRKKKCGHTNNLRPKKKVK
Tissue specificity:
Induction:
Developmental stage:
Protein families:eukaryotic ribosomal protein eL40 family