RHOB_RAT P62747
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P62747
Recommended name：Rho-related GTP-binding protein RhoB
EC number：
Alternative names：
Cleaved into：
GeneID：64373
Gene names (primary )：Rhob
Gene names (synonym )：Arhb
Gene names (ORF )：
Length：196
Mass：22,123
Sequence：MAAIRKKLVVVGDGACGKTCLLIVFSKDEFPEVYVPTVFENYVADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCFSVDSPDSLENIPEKWVPEVKHFCPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYLECSAKTKEGVREVFETATRAALQKRYGSQNGCINCCKVL
Tissue specificity：Expressed at very low levels in quiescent cells but is transiently induced by serum stimulation with levels increasing to a maximum within 30 minutes and declining over the next hour. 1
Induction：
Developmental stage：
Protein families：