ST1B1_RAT P52847
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P52847
Recommended name：Sulfotransferase 1B1
EC number：EC:2.8.2.1
Alternative names：ST1B1
Cleaved into：
GeneID：64305
Gene names (primary )：Sult1b1
Gene names (synonym )：St1b1
Gene names (ORF )：
Length：299
Mass：34,835
Sequence：MGTAEDVFRKDLKIIHGYPMVYAFALGWEKIEEFQSRPCDIVIPTYPKSGTTWLSEIVDMVLNDGNVEKCKRDVITSKVPMLEQNVPGARRSGVELLKKTPSPRIIKTHLPIDLLPKSFWDNKCKMIYLARNGKDVAVSYYHFDLMNNIQPLPGTWEEYLEKFLAGNVAYGSWFDHVKSWWEKREGHPILFLYYEDLKKNPKKEIKKIANFLDKTLDEHTLERIVHHTSFEVMKDNPLVNYTHLPTEIMDHSKSPFMRKGVVGDWKNYFTMTQSEKFDAIYKKKLSGTTLEFCTDIQSA
Tissue specificity：
Induction：
Developmental stage：
Protein families：