FOSL2_RAT   P51145


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P51145

Recommended name:Fos-related antigen 2

EC number:

Alternative names:

Cleaved into:

GeneID:25446

Gene names  (primary ):Fosl2

Gene names  (synonym ):Fra-2, Fra2

Gene names  (ORF ):

Length:326

Mass:35,255

Sequence:MYQDYPGNFDTSSRGSSGSPAHAESYSSGGGGQQKFRVDMPGSGSAFIPTINAITTSQDLQWMVQPTVITSMSNPYPRSHPYSPLPGLASVPGHMALPRPGVIKTIGTTVGRRRRDEQLSPEEEEKRRIRRERNKLAAAKCRNRRRELTEKLQAETEELEEEKSGLQKEIAELQKEKEKLEFMLVAHGPVCKISPEERRSPPTSGLQSLRGTGSAVGPVVVKQEPPEEDSPSSSAGMDKTQRSVIKPISIAGGGFYGEEPLHTPIVVTSTPAITPGTSNLVFTYPSVLEQESPASPSESCSKAHRRSSSSGDQSSDSLNSPTLLAL

Tissue specificity:Expressed in the brain cortex. Expressed at night in pineal gland (at protein level). Also expressed in osteoblasts (at protein level). 3 s

Induction:

Developmental stage:In the pineal gland, exhibits night/day variations with a 4-fold increased expression at night (at protein level). Up-regulation is due to a large degree to the release of norepinephrine from nerve terminals in the pineal gland and cAMP signaling pathway. Nocturnally elevated expression is also observed in the brain cortex. In osteoblasts, up-regulated by PGE2 (at protein level). 3 s

Protein families:


   💬 WhatsApp