RL4_RAT P50878
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P50878
Recommended name:Large ribosomal subunit protein uL4 Curated
EC number:
Alternative names:
Cleaved into:
GeneID:64302
Gene names (primary ):Rpl4
Gene names (synonym ):Rpl1
Gene names (ORF ):
Length:421
Mass:47,257
Sequence:MACARPLISVYSEKGESSGKNVTLPAVFKAPIRPDIVNFVHTNLRKNNRQPYAVSELAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKTWRRWHRRVNTTQKRYAICSALAASALPALVMSKGHCVEEVPELPLVVEDKVESYKKTKEAVQLLKKLKAWNDIKKVYASQRMRAGKGKMRNRRRIQRRGPCIIYNEDNGIIKAFRNIPGITLLNVSKLNILKLAPGGHVGRFCIWTESAFRKLDELYGTWRKAASLKSNYNLPMHKMMNTDLSRILKSPEIQRALRAPRKKIHRRVLKKNPLKNLRIMLKLNPYAKTMRRNTILRQARNHKLRVKKLEAAAAALAAKSEKIVPEKGAGDKKPAVGKKGKKPVDAKKLKKPAGKKVVTKKPAEKKPTTEEKKSAA
Tissue specificity:
Induction:
Developmental stage:
Protein families: