UD2A1_RAT P36510
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P36510
Recommended name：UDP-glucuronosyltransferase 2A1 Curated
EC number：EC:2.4.1.17
Alternative names：UDPGT 2A1; UGT2A1
Cleaved into：
GeneID：63867
Gene names (primary )：Ugt2a1
Gene names (synonym )：Ugt2a-1
Gene names (ORF )：
Length：527
Mass：59,916
Sequence：MLKNILLWSLQLSLLGMSLGGNVLIWPMEGSHWLNVKIIIDELLRKEHNVTVLVASGALFITPSVSPSLTFEIYPVPFGKEKIESVIKDFVLTWLENRPSPSTIWTFYKEMAKVIEEFHLVSRGICDGVLKNEKLMTKLQRGKFEVLLSDPVFPCGDIVALKLGIPFIYSLRFSPASTVEKHCGKVPFPPSYVPAILSELTDQMSFADRVRNFISYRMQDYMFETLWKQWDSYYSKALGRPTTLCETMGKAEIWLMRTYWDFEFPRPYLPNFEFVGGLHCKPAKPLPKEMEEFVQTSGEHGVVVFSLGSMVKNLTEEKANLIASALAQIPQKVLWRYKGKIPATLGSNTRLFDWIPQNDLLGHPKTRAFITHGGTNGIYEAIYHGIPMVGVPMFADQPDNIAHMKAKGAAVEVNMNTMTSADLLSAVRAVINEPFYKENAMRLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHDLSWFQYHSLDVIGFLLACMASAILLVIKCCLFVFQKIGKTXKKNKRD
Tissue specificity：Olfactory epithelium. Mainly found in the sustentacular cells and to a lesser extent in Bowman's gland cells. Also expressed in the olfactory sensory neuron nuclei. Neuronal localization within the olfactory bulb is mainly found in the deeper granular cells. 1
Induction：
Developmental stage：
Protein families：