AGTR2_RAT P35351
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P35351
Recommended name：Type-2 angiotensin II receptor 1 Publication
EC number：
Alternative names：
Cleaved into：
GeneID：24182
Gene names (primary )：Agtr2
Gene names (synonym )：
Gene names (ORF )：
Length：363
Mass：41,331
Sequence：MKDNFSFAATSRNITSSLPFDNLNATGTNESAFNCSHKPADKHLEAIPVLYYMIFVIGFAVNIVVVSLFCCQKGPKKVSSIYIFNLAVADLLLLATLPLWATYYSYRYDWLFGPVMCKVFGSFLTLNMFASIFFITCMSVDRYQSVIYPFLSQRRNPWQASYVVPLVWCMACLSSLPTFYFRDVRTIEYLGVNACIMAFPPEKYAQWSAGIALMKNILGFIIPLIFIATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALTWMGIINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFRVPITWLQGKRETMSCRKSSSLREMDTFVS
Tissue specificity：Abundant expression in fetal tissues, immature brain, skin wound and atretic ovarian follicles. 2 s
Induction：
Developmental stage：Abundant in whole fetus but decreases rapidly after birth. In adults is highly expressed in the adrenal, present in the brain and uterus but undetectable in the heart. 2 s
Protein families：G-protein coupled receptor 1 family