RAB8A_RAT   P35280


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P35280

Recommended name:Ras-related protein Rab-8A

EC number:EC:3.6.5.2

Alternative names:

Cleaved into:

GeneID:117103

Gene names  (primary ):Rab8a

Gene names  (synonym ):Rab8

Gene names  (ORF ):

Length:207

Mass:23,668

Sequence:MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQIWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILGNKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGNSPQGSSHGVKITVEQQKRTSFFRCSLL

Tissue specificity:Highest levels in spinal cord, heart, kidney and lung.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp