FOXA2_RAT P32182
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P32182
Recommended name：Hepatocyte nuclear factor 3-beta
EC number：
Alternative names：Forkhead box protein A2
Cleaved into：
GeneID：25099
Gene names (primary )：Foxa2
Gene names (synonym )：Hnf3b, Tcf-3b, Tcf3b
Gene names (ORF )：
Length：458
Mass：48,484
Sequence：MLGAVKMEGHEPSDWSSYYAEPEGYSSVSNMNASLGMNGMNTYMSMSAAAMGSGSGNMSAGSMNMSSYVGAGMSPSLAGMSPGAGAMAGMSGSAGAAGVAGMGPHLSPSLSPLGGQAAGAMGGLAPYANMNSMSPMYGQAGLSRARDPKTYRRSYTHAKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDFLKVPRAPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKCENELALKEAAGAGSGGGKKTAPGTQASQVQLGEAAGSASETPAGTESPHSSASPCQEHKRGGLSELKGTPASALSPPEPAPSPGQQQQAAAHLLGPPHHPGLPPEAHLKPEHHYAFNHPFSINNLMSSEQQHHHSHHHHQPHKMDLKTYEQVMHYPGGYGSPMPGSLAMGPVTNKAGLDASPLAADTSYYQGVYSRPIMNSS
Tissue specificity：Liver.
Induction：
Developmental stage：
Protein families：