S5A2_RAT   P31214


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P31214

Recommended name:3-oxo-5-alpha-steroid 4-dehydrogenase 2

EC number:EC:1.3.1.22

Alternative names:5 alpha-SR2 SR type 2 Steroid 5-alpha-reductase 2 (S5AR 2)

Cleaved into:

GeneID:64677

Gene names  (primary ):Srd5a2

Gene names  (synonym ):

Gene names  (ORF ):

Length:254

Mass:28,772

Sequence:MQIVCHQVPVLAGSATLATMGTLILCLGKPASYGKHTESVSSGVPFLPARIAWFLQELPSFVVSVGMLAWQPRSLFGPPGNVLLALFSAHYFHRTFIYSLLTRGRPFPAVLFLRATAFCIGNGLLQAYYLVYCAEYPEEWYTDVRFSFGVFLFILGMGINIHSDYTLRQLRKPGEVIYRIPRGGLFTYVSGANFLGEIIEWIGYALATWSVPAFAFAFFTLCFLGMQAFYHHRFYLKMFKDYPKSRKALIPFIF

Tissue specificity:Expressed in high levels in the prostate and many other androgen-sensitive tissues. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp