MIF_RAT P30904
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P30904
Recommended name:Macrophage migration inhibitory factor
EC number:EC:5.3.2.1
Alternative names:MIF
Cleaved into:
GeneID:81683
Gene names (primary ):Mif
Gene names (synonym ):
Gene names (ORF ):
Length:115
Mass:12,477
Sequence:MPMFIVNTNVPRASVPEGFLSELTQQLAQATGKPAQYIAVHVVPDQLMTFSGTSDPCALCSLHSIGKIGGAQNRNYSKLLCGLLSDRLHISPDRVYINYYDMNAANVGWNGSTFA
Tissue specificity:Expressed in a wide variety of organs including brain, spleen, liver, muscle and kidney. 1
Induction:
Developmental stage:
Protein families: