THTR_RAT   P24329


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P24329

Recommended name:Thiosulfate sulfurtransferase

EC number:EC:2.8.1.1

Alternative names:Rhodanese

Cleaved into:

GeneID:25274

Gene names  (primary ):Tst

Gene names  (synonym ):

Gene names  (ORF ):

Length:297

Mass:33,407

Sequence:MVHQVLYRALVSTKWLAESIRSGKVGPSLRVLDASWYSPGTRQARKEYQERHVPGASFFDIEECRDTTSPYEMMLPSEAHFGDYVGNLGISNDTHVVVYDGDDLGSFYAPRVWWMFRVFGHRTVSVLNGGFRNWLKEGHPVTSEPSRPEPAVFKATLNRSLLKTYEQVLENLQSKRFQLVDSRAQGRYLGTQPEPDAVGLDSGHIRGSVNVPFMNFLTEDGFEKSPEELRAIFQDKKVDLSQPLIATCRKGVTACHIALAAYLCGKPDVAVYDGSWSEWFRRAPPETRVSQGKSGKA

Tissue specificity:Expressed in numerous tissues. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp