S5A1_RAT P24008
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P24008
Recommended name：3-oxo-5-alpha-steroid 4-dehydrogenase 1 Curated
EC number：EC:1.3.1.22
Alternative names：SR type 1 Steroid 5-alpha-reductase 1 (S5AR 1)
Cleaved into：
GeneID：
Gene names (primary )：Srd5a1
Gene names (synonym )：
Gene names (ORF )：
Length：259
Mass：29,780
Sequence：MVPLMELDELCLLDMLVYLEGFMAFVSIVGLRSVGSPYGRYSPQWPGIRVPARPAWFIQELPSMAWPLYEYIRPAAARLGNLPNRVLLAMFLIHYVQRTLVFPVLIRGGKPTLLVTFVLAFLFCTFNGYVQSRYLSQFAVYAEDWVTHPCFLTGFALWLVGMVINIHSDHILRNLRKPGETGYKIPRGGLFEYVSAANYFGELVEWCGFALASWSLQGVVFALFTLSTLLTRAKQHHQWYHEKFEDYPKSRKILIPFVL
Tissue specificity：Liver and prostate (at a low level).
Induction：After the establishment of chromosomal sex at fertilization.
Developmental stage：Its expression is regulated by androgens such as testosterone.
Protein families：