GPX3_RAT P23764
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P23764
Recommended name:Glutathione peroxidase 3 Curated
EC number:EC:1.11.1.9
Alternative names:GPx-3; GSHPx-3
Cleaved into:
GeneID:64317
Gene names (primary ):Gpx3
Gene names (synonym ):
Gene names (ORF ):
Length:226
Mass:25,424
Sequence:MARILRASCLLSLLLAGFVPPGRGQEKSKTDCHGGMSGTIYEYGALTIDGEEYIPFKQYAGKYILFVNVASYUGLTDQYLELNALQEELGPFGLVILGFPCNQFGKQEPGENSEILPSLKYVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTAELLGSPGRLFWEPMKIHDIRWNFEKFLVGPDGIPIMRWYHRTTVSNVKMDILSYMRRQAALGARGK
Tissue specificity:Secreted in plasma.
Induction:
Developmental stage:
Protein families: