ST2A6_RAT P22789
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P22789
Recommended name：Sulfotransferase 2A6 Curated
EC number：EC:2.8.2.2
Alternative names：ST2A6
Cleaved into：
GeneID：24902
Gene names (primary )：Sult2a6
Gene names (synonym )：Smp2a, St2a2
Gene names (ORF )：
Length：284
Mass：33,252
Sequence：MPDYTWFEGIPFPAFGIPKETLQNVCNKFVVKEEDLILLTYPKSGTNWLIEIVCLIQTKGDPKWIQSVTIWDRSPWIETDLGYDMLIKKKGPRLITSHLPMHLFSKSLFSSKAKVIYLIRNPRDVLVSGYYFWGKTTLAKKPDSLGTYVEWFLKGYVPYGSWFEHIRAWLSMRELDNFLLLYYEDMKKDTMGTIKKICDFLGKKLEPDELDLVLKYSSFQVMKENNMSNYNLMEKELILPGFTFMRNGTTGDWKNHFTVAQAEAFDKVFQEKMAGFPPGMFPWD
Tissue specificity：Liver, exhibiting a sex-dependent spatial localization in the lobule of the liver. 1
Induction：There is a marked sex difference (female >> male) in the cytosolic level of this protein. Its activity increases after birth in parallel in both sexes until the weanling stage. Thereafter the activity decreases in males, whereas it declines temporarily in females and increases again to a maximum level in adult females. 1 Publication
Developmental stage：The ST activities display gender- and age-dependent alterations and are known to be under the regulation of gonadal, adrenal and growth hormones.
Protein families：