VEGFA_RAT P16612
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P16612
Recommended name:Vascular endothelial growth factor A
EC number:
Alternative names:Vascular permeability factor (VPF)
Cleaved into:
GeneID:
Gene names (primary ):Vegfa
Gene names (synonym ):Vegf
Gene names (ORF ):
Length:214
Mass:25,239
Sequence:MNFLLSWVHWTLALLLYLHHAKWSQAAPTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKKSVRGKGKGQKRKRKKSRFKSWSVHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Tissue specificity:Expressed in the pituitary, in brain, in particularly in supraoptic and paraventricular nuclei and the choroid plexus. Also found abundantly in the corpus luteum of the ovary and in kidney glomeruli. Expressed in the ductal epithelial cells of post-pubertal mammary glands. Expressed in the ductal and alveolar epithelial cells throughout the whole period of gestational evolution, lactation and involution. 1
Induction:
Developmental stage:Increases during pregnancy (5.0-fold increase on day 12 with a subsequent decrease on day 18) and during lactation (18.5-fold increase on day 7). Levels appear to be minimally altered during involution. 1
Protein families: