NMU_RAT P12760
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P12760
Recommended name：Neuromedin-U
EC number：
Alternative names：
Cleaved into：
GeneID：63887
Gene names (primary )：Nmu
Gene names (synonym )：
Gene names (ORF )：
Length：174
Mass：19,403
Sequence：MSRAANRRPGLSAGQLAAATASPLLSLLLLLACCADACRGTPISPQRLPPEQELQLWNEIPEACASFLSVDSQPQASVALRKLCRVLMEIFQKPQEQTEKDNAKRFLFHYSKTQKLGNSNVVSSVVHPLLQLVPQLHERRMKRYKVNEYQGPVAPSGGFFLFRPRNGKRSTSFI
Tissue specificity：Expressed throughout the gastrointestinal tract with highest levels in the duodenum and jejunum (PubMed:7916966). Low levels in spinal cord, hypothalamus, and stomach (PubMed:7916966). Neuromedin-U-23: Expressed in the small intestine and the pituitary gland (at protein level) (PubMed:28874765). Neuromedin precursor-related peptides: Expressed in pituitary gland and small intestine (at protein level) (PubMed:28874765). 2 s
Induction：
Developmental stage：
Protein families：