SCP2_RAT   P11915


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P11915

Recommended name:Sterol carrier protein 2 Curated

EC number:

Alternative names:Acetyl-CoA C-myristoyltransferase 2 Publications (EC:2.3.1.155 2 Publications) . EC:2.3.1.155 (UniProtKB | ENZYME | Rhea) 2 Publications Non-specific lipid-transfer protein (NSL-TP) Propanoyl-CoA C-acyltransferase (EC:2.3.1.176 3 Publications) . EC:2.3.1.176 (UniProtKB | ENZYME | Rhea) 3 Publications SCP-2/3-oxoacyl-CoA thiolase 1 Publication SCP-2/thiolase 1 Publication (EC:2.3.1.16 2 Publications) . EC:2.3.1.16 (UniProtKB | ENZYME | Rhea) 2 Publications More alternative names

Cleaved into:

GeneID:

Gene names  (primary ):Scp2

Gene names  (synonym ):Scp-2

Gene names  (ORF ):

Length:547

Mass:58,813

Sequence:MPSVALNSPRLPRVFVVGVGMTKFMKPGGENSRDYPDLAKEAGQKALADRQIPYSAVEQACVGYVYGESTCGQRAIYHSLGLTGIPIINVNNNCSTGSTALFMAQQLVQGGLANCVLALGFEKMEKGSLGTKYSDRSNPLEKHIDVLINKYGMSACPFAPQLFGSAGKEHMETYGTKVEHFAKIGWKNHKHSVNNPYSQFQDEYSLDEIMKSRPVFDFLTVLQCCPTSDGAAAAIVSSEEFVQKHGLQSKAVEIVAQEMVTDMPSTFEEKSVIKMVGYDMSKEAARKCYEKSGLGPSDVDVIELHDCFSTNELLTYEALGLCPEGQGGALVDRGDNTYGGKWVINPSGGLISKGHPLGATGLAQCAELCWQLRGEAGKRQVPGAKVALQHNLGLGGAAVVTLYRMGFPEAASSFRTHQISAAPTSSAGDGFKANLIFKEIEKKLEEEGEEFVKKIGGIFAFKVKDGPGGKEATWVVDVKNGKGSVLPDSDKKADCTITMADSDLLALMTGKMNPQSAFFQGKLKIAGNMGLAMKLQSLQLQPDKAKL

Tissue specificity:Liver > intestine > brain > lung, colon, stomach, spleen, kidney, heart and ovary.

Induction:Expressed in liver (at protein level). 1 Publication

Developmental stage:Expressed in liver (at protein level). 1

Protein families:


   💬 WhatsApp