CP2A1_RAT P11711
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P11711
Recommended name：Cytochrome P450 2A1
EC number：EC:1.14.14.1
Alternative names：CYPIIA1 Cytochrome P450-UT-F Steroid hormones 7-alpha-hydroxylase Testosterone 7-alpha-hydroxylase
Cleaved into：
GeneID：24894
Gene names (primary )：Cyp2a1
Gene names (synonym )：Cyp2a-1
Gene names (ORF )：
Length：492
Mass：55,995
Sequence：MLDTGLLLVVILASLSVMLLVSLWQQKIRGRLPPGPTPLPFIGNYLQLNTKDVYSSITQLSERYGPVFTIHLGPRRVVVLYGYDAVKEALVDQAEEFSGRGEQATYNTLFKGYGVAFSSGERAKQLRRLSIATLRDFGVGKRGVEERILEEAGYLIKMLQGTCGAPIDPTIYLSKTVSNVISSIVFGERFDYEDTEFLSLLQMMGQMNRFAASPTGQLYDMFHSVMKYLPGPQQQIIKVTQKLEDFMIEKVRQNHSTLDPNSPRNFIDSFLIRMQEEKNGNSEFHMKNLVMTTLSLFFAGSETVSSTLRYGFLLLMKHPDVEAKVHEEIEQVIGRNRQPQYEDHMKMPYTQAVINEIQRFSNLAPLGIPRRIIKNTTFRGFFLPKGTDVFPILGSLMTDPKFFPSPKDFDPQNFLDDKGQLKKNAAFLPFSTGKRFCLGDGLAKMELFLLLTTILQNFRFKFPMKLEDINESPKPLGFTRIIPKYTMSFMPI
Tissue specificity：Liver and testis.
Induction：
Developmental stage：By 3-methylcholanthrene (3MC).
Protein families：