EGR1_RAT P08154
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P08154
Recommended name：Early growth response protein 1
EC number：
Alternative names：Nerve growth factor-induced protein A 1 Publication (NGFI-A 1 Publication) Transcription factor Zif268 Zinc finger protein Krox-24
Cleaved into：
GeneID：24330
Gene names (primary )：Egr1
Gene names (synonym )：
Gene names (ORF )：
Length：508
Mass：53,935
Sequence：MDNYPKLEEMMLLSNGAPQFLGAAGTPEGSGGNNSSSSSSSSSGGGGGGGSNSGSSAFNPQGEPSEQPYEHLTTESFSDIALNNEKALVETSYPSQTTRLPPITYTGRFSLEPAPNSGNTLWPEPLFSLVSGLVSMTNPPTSSSSAPSPAASSSSSASQSPPLSCAVPSNDSSPIYSAAPTFPTPNTDIFPEPQSQAFPGSAGTALQYPPPAYPATKGGFQVPMIPDYLFPQQQGDLSLGTPDQKPFQGLENRTQQPSLTPLSTIKAFATQSGSQDLKALNNTYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQKDKKADKSVVASSAASSLSSYPSPVATSYPSPATTSFPSPVPTSYSSPGSSTYPSPAHSGFPSPSVATTYASVPPAFPAQVSTFQSAGVSNSFSTSTGLSDMTATFSPRTIEIC
Tissue specificity：Detected in kidney thick ascending limbs and collecting ducts (at protein level). 1
Induction：
Developmental stage：By growth factors (PubMed:2492104). Rapidly and transiently up-regulated in response to ischemia (PubMed:1859855). 2 s
Protein families：EGR C2H2-type zinc-finger protein family