NEUM_RAT P07936
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P07936
Recommended name：Neuromodulin
EC number：
Alternative names：
Cleaved into：
GeneID：29423
Gene names (primary )：Gap43
Gene names (synonym )：
Gene names (ORF )：
Length：226
Mass：23,603
Sequence：MLCCMRRTKQVEKNDEDQKIEQDGVKPEDKAHKAATKIQASFRGHITRKKLKDEKKGDAPAAEAEAKEKDDAPVADGVEKKEGDGSATTDAAPATSPKAEEPSKAGDAPSEEKKGEGDAAPSEEKAGSAETESAAKATTDNSPSSKAEDGPAKEEPKQADVPAAVTDAAATTPAAEDAAKAAQPPTETAESSQAEEEKEAVDEAKPKESARQDEGKEDPEADQEHA
Tissue specificity：Expressed in hippocampal neurons, with highest levels of expression in the CA4 and CA3 neurons and lower levels in CA1 neurons (PubMed:11948657, PubMed:17577668). Expressed in the dorsal root ganglion (PubMed:12957493). 3 s
Induction：Expression in dentate granule cells of the hippocampus at postnatal day P5, with disappearing expression in dentate granule cells as early as P14. 1 Publication
Developmental stage：Up-regulated by kainic acid-induced seizures (PubMed:17577668). Up-regulated after axotomy (PubMed:12957493). 2 s
Protein families：