H1T_RAT P06349
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P06349
Recommended name：Histone H1t
EC number：
Alternative names：
Cleaved into：
GeneID：24438
Gene names (primary )：H1-6 By Similarity
Gene names (synonym )：H1f6 Imported, H1ft, H1t
Gene names (ORF )：
Length：208
Mass：21,726
Sequence：MSETAPAASSTLVPAPVEKPATKRRGKKPGMATARKPRGFSVSKLIPEALSMSQERAGMSLAALKKALAAAGYDVEKNNSRIKLALKRLVNKGVLVQTKGTGASGSFKLSKKAASGNDKGKGKKSASAKAKKLGLSRASRSPKSSKTKVVKKPKATPTKGSGSRRKTKGAKGLQQRKSPAKARATNSNSGKSKMVMQKTDLRKAAGRK
Tissue specificity：Testis-specific (PubMed:1706721, PubMed:2423516). Expressed in pachytene spermatocytes during meiotic prophase I (PubMed:1706721). 2 s
Induction：
Developmental stage：This histone is a testis-specific H1 variant that appears during meiosis in spermatogenesis. 1
Protein families：histone H1/H5 family